Lineage for d6erdc1 (6erd C:44-210)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. Protein automated matches [190038] (49 species)
    not a true protein
  7. Species Bacillus cereus [TaxId:226900] [358002] (1 PDB entry)
  8. Domain d6erdc1: 6erd C:44-210 [358078]
    Other proteins in same PDB: d6erda2, d6erdb2, d6erdc2, d6erdd2
    automated match to d5cnpb_
    complexed with cl, gol

Details for d6erdc1

PDB Entry: 6erd (more details), 2 Å

PDB Description: crystal structure of a putative acetyltransferase from bacillus cereus species.
PDB Compounds: (C:) Aminoglycoside N6'-acetyltransferase

SCOPe Domain Sequences for d6erdc1:

Sequence, based on SEQRES records: (download)

>d6erdc1 d.108.1.0 (C:44-210) automated matches {Bacillus cereus [TaxId: 226900]}
iklesfkksdfkqlinwinseefliqwsgnaftfpldeqqlekyiesantlafkvvdeet
sdvighislgqidninksarigkvlvgntkmrgrsigkhmmkavlhiafdelklhrvtlg
vydfntsaiscyekigfvkegllreskrvgetywnlwemsmleyewk

Sequence, based on observed residues (ATOM records): (download)

>d6erdc1 d.108.1.0 (C:44-210) automated matches {Bacillus cereus [TaxId: 226900]}
iklesfkksdfkqlinwinseefliqwsgnaftfpldeqqlekyiesantlafkvvdeet
sdvighislgqidninksarigkvlvgnrsigkhmmkavlhiafdelklhrvtlgvydfn
tsaiscyekigfvkegllreskrvgetywnlwemsmleyewk

SCOPe Domain Coordinates for d6erdc1 are not available.

Timeline for d6erdc1:

Domains from same chain:
(mouse over for more information)
d6erdc2
Domains from other chains:
(mouse over for more information)
d6erda1, d6erda2, d6erdb1, d6erdb2, d6erdd1, d6erdd2