SCOPe 2.08: Domain d6mgga2: 6mgg A:123-290

Lineage for d6mgga2 (6mgg A:123-290)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families)

5. Family c.23.4.0: automated matches [227303] (1 protein)
   not a true family

6. Protein automated matches [227129] (4 species)
   not a true protein

7. Species Francisella tularensis [TaxId:177416] [358070] (2 PDB entries)

8. Domain d6mgga2: 6mgg A:123-290 [358073]
   Other proteins in same PDB: d6mgga1, d6mgga3, d6mggb1, d6mggc1, d6mggc3, d6mggd1
   automated match to d2yv1a2
   complexed with coa, edo, mg

Details for d6mgga2

PDB Entry: 6mgg, 1.78 Å

PDB Description: succinyl-coa synthase from francisella tularensis, phosphorylated, in complex with coa

PDB Compounds: (A:) Succinate--CoA ligase [ADP-forming] subunit alpha

SCOPe Domain Sequences for d6mgga2:

Sequence; same for both SEQRES and ATOM records:

>d6mgga2 c.23.4.0 (A:123-290) automated matches {Francisella tularensis [TaxId: 177416]}
ncpgiitpgeckigimpghihmkgkvgiisrsgtltyeavaqttklgfgqstcigiggdp
ipgmnqiealkllendpqteaiiligeiggtaeeeaaeyikhnvtkpvigyiagvtappg
krmghagaiisggkgtaeekfaafeaagiaytrspaeigkklkevtgw

Timeline for d6mgga2:

• d6mgga2 first appeared in SCOPe 2.07