Lineage for d6g46d1 (6g46 D:8-120)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2764739Superfamily b.1.12: Purple acid phosphatase, N-terminal domain [49363] (2 families) (S)
  5. 2764758Family b.1.12.0: automated matches [227279] (1 protein)
    not a true family
  6. 2764759Protein automated matches [227090] (1 species)
    not a true protein
  7. 2764760Species French bean (Phaseolus vulgaris) [TaxId:3885] [226471] (11 PDB entries)
  8. 2764788Domain d6g46d1: 6g46 D:8-120 [358059]
    Other proteins in same PDB: d6g46a2, d6g46b2, d6g46c2, d6g46d2
    automated match to d1kbpa1
    complexed with edo, elh, fe, gol, ipa, na, nag, so4, zn

Details for d6g46d1

PDB Entry: 6g46 (more details), 2.4 Å

PDB Description: red kidney bean purple acid phosphatase in complex with 2-(naphthalen- 1-yl)thiazole-4-carboxylic acid
PDB Compounds: (D:) Fe(3+)-Zn(2+) purple acid phosphatase

SCOPe Domain Sequences for d6g46d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6g46d1 b.1.12.0 (D:8-120) automated matches {French bean (Phaseolus vulgaris) [TaxId: 3885]}
nrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrk
riakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitpp

SCOPe Domain Coordinates for d6g46d1:

Click to download the PDB-style file with coordinates for d6g46d1.
(The format of our PDB-style files is described here.)

Timeline for d6g46d1: