Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins) |
Protein Histidine-binding protein [53872] (2 species) |
Species Escherichia coli [TaxId:562] [53873] (1 PDB entry) |
Domain d1hslb_: 1hsl B: [35805] complexed with cd, his |
PDB Entry: 1hsl (more details), 1.89 Å
SCOPe Domain Sequences for d1hslb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hslb_ c.94.1.1 (B:) Histidine-binding protein {Escherichia coli [TaxId: 562]} aipqkirigtdptyapfesknaqgelvgfdidlakelckrintqctfvenpldalipslk akkidaimsslsitekrqqeiaftdklyaadsrlvvaknsdiqptvaslkgkrvgvlqgt tqetfgnehwapkgieivsyqgqdniysdltagridaafqdevaasegflkqpvgkdykf ggpavkdeklfgvgtgmglrkednelrealnkafaemradgtyeklakkyfdfdvygg
Timeline for d1hslb_: