SCOPe 2.07: Domain d6e3hl2: 6e3h L:107-214

Lineage for d6e3hl2 (6e3h L:107-214)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d6e3hl2: 6e3h L:107-214 [358047]
   Other proteins in same PDB: d6e3ha1, d6e3ha2, d6e3hb1, d6e3hb2, d6e3hl1
   automated match to d4oawa2
   complexed with bma, fuc, nag

Details for d6e3hl2

PDB Entry: 6e3h, 2.9 Å

PDB Description: crystal structure of s9-3-37 bound to h5 influenza hemagglutinin

PDB Compounds: (L:) antibody S9-3-37 light chain

SCOPe Domain Sequences for d6e3hl2:

Sequence; same for both SEQRES and ATOM records:

>d6e3hl2 b.1.1.2 (L:107-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhklyacevthqglsspvtksfnrgec

Timeline for d6e3hl2:

• d6e3hl2 is new in SCOPe 2.07-stable
  
• d6e3hl2 appears in the current release, SCOPe 2.08