SCOPe 2.07: Domain d6e3hl1: 6e3h L:1-106

Lineage for d6e3hl1 (6e3h L:1-106)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d6e3hl1: 6e3h L:1-106 [358046]
   Other proteins in same PDB: d6e3ha1, d6e3ha2, d6e3hb1, d6e3hb2, d6e3hl2
   automated match to d4oawa1
   complexed with bma, fuc, nag

Details for d6e3hl1

PDB Entry: 6e3h, 2.9 Å

PDB Description: crystal structure of s9-3-37 bound to h5 influenza hemagglutinin

PDB Compounds: (L:) antibody S9-3-37 light chain

SCOPe Domain Sequences for d6e3hl1:

Sequence; same for both SEQRES and ATOM records:

>d6e3hl1 b.1.1.0 (L:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvvltqtplsspvtrgqaasiscrssqslvhsdgntylswihqrpgqpprlliykiskrf
sgvpdrisgsgagteftltisrveaddvgmyyctqasqfprtfgqgtklei

Timeline for d6e3hl1:

• d6e3hl1 is new in SCOPe 2.07-stable
  
• d6e3hl1 appears in the current release, SCOPe 2.08