Lineage for d6e3hl1 (6e3h L:1-106)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2369227Domain d6e3hl1: 6e3h L:1-106 [358046]
    Other proteins in same PDB: d6e3ha1, d6e3ha2, d6e3hb1, d6e3hb2, d6e3hl2
    automated match to d4oawa1
    complexed with bma, fuc, nag

Details for d6e3hl1

PDB Entry: 6e3h (more details), 2.9 Å

PDB Description: crystal structure of s9-3-37 bound to h5 influenza hemagglutinin
PDB Compounds: (L:) antibody S9-3-37 light chain

SCOPe Domain Sequences for d6e3hl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6e3hl1 b.1.1.0 (L:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvvltqtplsspvtrgqaasiscrssqslvhsdgntylswihqrpgqpprlliykiskrf
sgvpdrisgsgagteftltisrveaddvgmyyctqasqfprtfgqgtklei

SCOPe Domain Coordinates for d6e3hl1:

Click to download the PDB-style file with coordinates for d6e3hl1.
(The format of our PDB-style files is described here.)

Timeline for d6e3hl1: