Class g: Small proteins [56992] (98 folds) |
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) |
Family g.39.1.2: Nuclear receptor [57721] (13 proteins) duplication: two zinc-binding motifs |
Protein automated matches [190314] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188623] (7 PDB entries) |
Domain d6cfnb_: 6cfn B: [358045] automated match to d1kb2b_ complexed with zn |
PDB Entry: 6cfn (more details), 2.5 Å
SCOPe Domain Sequences for d6cfnb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6cfnb_ g.39.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} klclvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncpacry rkclqagmnl
Timeline for d6cfnb_: