Lineage for d6cfnb_ (6cfn B:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640292Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 2640293Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 2640318Family g.39.1.2: Nuclear receptor [57721] (13 proteins)
    duplication: two zinc-binding motifs
  6. 2640400Protein automated matches [190314] (3 species)
    not a true protein
  7. 2640404Species Human (Homo sapiens) [TaxId:9606] [188623] (7 PDB entries)
  8. 2640409Domain d6cfnb_: 6cfn B: [358045]
    automated match to d1kb2b_
    complexed with zn

Details for d6cfnb_

PDB Entry: 6cfn (more details), 2.5 Å

PDB Description: crystal structure of the dna-free glucocorticoid receptor dna binding domain
PDB Compounds: (B:) Glucocorticoid receptor

SCOPe Domain Sequences for d6cfnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cfnb_ g.39.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
klclvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncpacry
rkclqagmnl

SCOPe Domain Coordinates for d6cfnb_:

Click to download the PDB-style file with coordinates for d6cfnb_.
(The format of our PDB-style files is described here.)

Timeline for d6cfnb_: