Lineage for d1hsla_ (1hsl A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 710610Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 710611Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 710612Family c.94.1.1: Phosphate binding protein-like [53851] (35 proteins)
  6. 710947Protein Histidine-binding protein [53872] (2 species)
  7. 710948Species Escherichia coli [TaxId:562] [53873] (1 PDB entry)
  8. 710949Domain d1hsla_: 1hsl A: [35804]

Details for d1hsla_

PDB Entry: 1hsl (more details), 1.89 Å

PDB Description: refined 1.89 angstroms structure of the histidine-binding protein complexed with histidine and its relationship with many other active transport(slash)chemosensory receptors
PDB Compounds: (A:) histidine-binding protein

SCOP Domain Sequences for d1hsla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hsla_ c.94.1.1 (A:) Histidine-binding protein {Escherichia coli [TaxId: 562]}
aipqkirigtdptyapfesknaqgelvgfdidlakelckrintqctfvenpldalipslk
akkidaimsslsitekrqqeiaftdklyaadsrlvvaknsdiqptvaslkgkrvgvlqgt
tqetfgnehwapkgieivsyqgqdniysdltagridaafqdevaasegflkqpvgkdykf
ggpavkdeklfgvgtgmglrkednelrealnkafaemradgtyeklakkyfdfdvygg

SCOP Domain Coordinates for d1hsla_:

Click to download the PDB-style file with coordinates for d1hsla_.
(The format of our PDB-style files is described here.)

Timeline for d1hsla_: