Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries) |
Domain d6ev2f1: 6ev2 F:1-106 [358037] Other proteins in same PDB: d6ev2b2, d6ev2d2, d6ev2f2, d6ev2h2 automated match to d1um5l1 complexed with bgc |
PDB Entry: 6ev2 (more details), 2.4 Å
SCOPe Domain Sequences for d6ev2f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ev2f1 b.1.1.0 (F:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]} divltqspaimsaspgekvtmtcsasssvsymhwyqqksgtspkrwiydtsklasgvpar fsgsgsgtsysltissmeaedaatyycqqwssnpptfgagtklelk
Timeline for d6ev2f1: