SCOPe 2.08: Domain d1dppe_: 1dpp E:

Lineage for d1dppe_ (1dpp E:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein Dipeptide-binding protein [53870] (1 species)
   similar domain organization to oligopeptide-binding protein, OPPA

7. Species Escherichia coli [TaxId:562] [53871] (2 PDB entries)

8. Domain d1dppe_: 1dpp E: [35802]
   complexed with gly, leu
   has additional subdomain(s) that are not in the common domain

Details for d1dppe_

PDB Entry: 1dpp, 3.2 Å

PDB Description: dipeptide binding protein complex with glycyl-l-leucine

PDB Compounds: (E:) dipeptide binding protein

SCOPe Domain Sequences for d1dppe_:

Sequence; same for both SEQRES and ATOM records:

>d1dppe_ c.94.1.1 (E:) Dipeptide-binding protein {Escherichia coli [TaxId: 562]}
ktlvycsegspegfnpqlftsgttydassvplynrlvefkigttevipglaekwevsedg
ktytfhlrkgvkwhdnkefkptrelnaddvvfsfdrqknaqnpyhkvsggsyeyfegmgl
pelisevkkvddntvqfvltrpeapfladlamdfasilskeyadammkagtpekldlnpi
gtgpfqlqqyqkdsrirykafdgywgtkpqidtlvfsitpdasvryaklqknecqvmpyp
npadiarmkqdksinlmempglnvgylsynvqkkplddvkvrqaltyavnkdaiikavyq
gagvsaknlipptmwgynddvqdytydpekakallkeaglekgfsidlwampvqrpynpn
arrmaemiqadwakvgvqakivtyewgeylkrakdgehqtvmmgwtgdngdpdnffatlf
scaaseqgsnyskwcykpfedliqparatddhnkrvelykqaqvvmhdqapaliiahstv
fepvrkevkgyvvdplgkhhfenvsie

Timeline for d1dppe_:

• d1dppe_ first appeared (with stable ids) in SCOP 1.55
  
• d1dppe_ appears in SCOPe 2.07