Lineage for d6cuzd_ (6cuz D:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. Protein automated matches [190054] (13 species)
    not a true protein
  7. Species Pyrococcus furiosus [TaxId:186497] [279274] (15 PDB entries)
  8. Domain d6cuzd_: 6cuz D: [358005]
    automated match to d1v8zb_
    complexed with fev, na, po4

Details for d6cuzd_

PDB Entry: 6cuz (more details), 1.7500000000000002 Å

PDB Description: engineered trpb from pyrococcus furiosus, pftrpb7e6 with (2s,3r)- ethylserine bound as the amino-acrylate
PDB Compounds: (D:) Tryptophan synthase beta chain 1

SCOPe Domain Sequences for d6cuzd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cuzd_ c.79.1.1 (D:) automated matches {Pyrococcus furiosus [TaxId: 186497]}
mwfgefggqyvpetlvgplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
ekiggakiylkredlvhggahktnnaigqaplaklmgktrliaetgagqhgvatamagal
lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtakdainealrdweatfeyth
yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
ndkkvklvgveaggkglesgkhsaslnagqvgvlhgmlsyflqdeegqikpshsiapgld
ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
srdeiiivnlsgrgdkdldivlkas

SCOPe Domain Coordinates for d6cuzd_ are not available.

Timeline for d6cuzd_:

Domains from other chains:
(mouse over for more information)
d6cuza_, d6cuzb_, d6cuzc_