![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) ![]() |
![]() | Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
![]() | Protein automated matches [190038] (49 species) not a true protein |
![]() | Species Bacillus cereus [TaxId:226900] [358002] (1 PDB entry) |
![]() | Domain d6erdd1: 6erd D:44-211 [358003] Other proteins in same PDB: d6erda2, d6erdb2, d6erdc2, d6erdd2 automated match to d5cnpb_ complexed with cl, gol |
PDB Entry: 6erd (more details), 2 Å
SCOPe Domain Sequences for d6erdd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6erdd1 d.108.1.0 (D:44-211) automated matches {Bacillus cereus [TaxId: 226900]} iklesfkksdfkqlinwinseefliqwsgnaftfpldeqqlekyiesantlafkvvdeet sdvighislgqidninksarigkvlvgntkmrgrsigkhmmkavlhiafdelklhrvtlg vydfntsaiscyekigfvkegllreskrvgetywnlwemsmleyewkk
Timeline for d6erdd1: