SCOPe 2.07: Domain d6e3hb1: 6e3h B:1-174

Lineage for d6e3hb1 (6e3h B:1-174)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.0: automated matches [254278] (1 protein)
   not a true family

6. Protein automated matches [254645] (42 species)
   not a true protein

7. Species Influenza A virus (a/chicken/guangdong/s1311/2010(h6n6)) [TaxId:1454272] [275804] (6 PDB entries)

8. Domain d6e3hb1: 6e3h B:1-174 [357996]
   Other proteins in same PDB: d6e3ha1, d6e3ha2, d6e3hb2, d6e3hl1, d6e3hl2
   automated match to d5bnyf_
   complexed with bma, fuc, nag

Details for d6e3hb1

PDB Entry: 6e3h, 2.9 Å

PDB Description: crystal structure of s9-3-37 bound to h5 influenza hemagglutinin

PDB Compounds: (B:) hemagglutinin HA2

SCOPe Domain Sequences for d6e3hb1:

Sequence; same for both SEQRES and ATOM records:

>d6e3hb1 h.3.1.0 (B:1-174) automated matches {Influenza A virus (a/chicken/guangdong/s1311/2010(h6n6)) [TaxId: 1454272]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeis

Timeline for d6e3hb1:

• d6e3hb1 is new in SCOPe 2.07-stable
  
• d6e3hb1 appears in the current release, SCOPe 2.08