| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
| Family h.3.1.0: automated matches [254278] (1 protein) not a true family |
| Protein automated matches [254645] (42 species) not a true protein |
| Species Influenza A virus (a/chicken/guangdong/s1311/2010(h6n6)) [TaxId:1454272] [275804] (6 PDB entries) |
| Domain d6e3hb1: 6e3h B:1-174 [357996] Other proteins in same PDB: d6e3ha1, d6e3ha2, d6e3hb2, d6e3hl1, d6e3hl2 automated match to d5bnyf_ complexed with bma, fuc, nag |
PDB Entry: 6e3h (more details), 2.9 Å
SCOPe Domain Sequences for d6e3hb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6e3hb1 h.3.1.0 (B:1-174) automated matches {Influenza A virus (a/chicken/guangdong/s1311/2010(h6n6)) [TaxId: 1454272]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeis
Timeline for d6e3hb1:
View in 3DDomains from other chains: (mouse over for more information) d6e3ha1, d6e3ha2, d6e3hl1, d6e3hl2 |