Lineage for d6e3ha1 (6e3h A:11-324)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2385148Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2385149Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2385894Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2385895Protein automated matches [227017] (57 species)
    not a true protein
  7. 2386336Species Influenza A virus, different strains [TaxId:11320] [228462] (34 PDB entries)
  8. 2386427Domain d6e3ha1: 6e3h A:11-324 [357993]
    Other proteins in same PDB: d6e3ha2, d6e3hb1, d6e3hb2, d6e3hl1, d6e3hl2
    automated match to d3m5ja_
    complexed with bma, fuc, nag

Details for d6e3ha1

PDB Entry: 6e3h (more details), 2.9 Å

PDB Description: crystal structure of s9-3-37 bound to h5 influenza hemagglutinin
PDB Compounds: (A:) hemagglutinin HA1

SCOPe Domain Sequences for d6e3ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6e3ha1 b.19.1.0 (A:11-324) automated matches {Influenza A virus, different strains [TaxId: 11320]}
dqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh
pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlatglrnsp

SCOPe Domain Coordinates for d6e3ha1:

Click to download the PDB-style file with coordinates for d6e3ha1.
(The format of our PDB-style files is described here.)

Timeline for d6e3ha1: