SCOP 1.75: Domain d1dpea_: 1dpe A:

Lineage for d1dpea_ (1dpe A:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (3 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (40 proteins)

6. Protein Dipeptide-binding protein [53870] (1 species)
   similar domain organization to oligopeptide-binding protein, OPPA

7. Species Escherichia coli [TaxId:562] [53871] (2 PDB entries)

8. Domain d1dpea_: 1dpe A: [35799]
   complexed with cd

Details for d1dpea_

PDB Entry: 1dpe, 2 Å

PDB Description: dipeptide-binding protein

PDB Compounds: (A:) dipeptide-binding protein

SCOP Domain Sequences for d1dpea_:

Sequence; same for both SEQRES and ATOM records:

>d1dpea_ c.94.1.1 (A:) Dipeptide-binding protein {Escherichia coli [TaxId: 562]}
ktlvycsegspegfnpqlfisgttydassvplynrlvefkigttevipglaekwevsedg
ktytfhlrkgvkwhdnkefkptrelnaddvvfsfdrqknaqnpyhkvsggsyeyfegmgl
pelisevkkvddntvqfvltrpeapfladlamdfasilskeyadammkagtpekldlnpi
gtgpfqlqqyqkdsrirykafdgywgtkpqidtlvfsitpdasvryaklqknecqvmpyp
npadiarmkqdksinlmempglnvgylsynvqkkplddvkvrqaltyavnkdaiikavyq
gagvsaknlipptmwgynddvqdytydpekakallkeaglekgfsidlwampvqrpynpn
arrmaemiqadwakvgvqakivtyewgeylkrakdgehqtvmmgwtgdngdpdnffatef
scaaseqgsnyskwcykpfedliqparatddhnkrvelykqaqvvmhdqapaliiahstv
fepvrkevkgyvvdplgkhhfenvsie

Timeline for d1dpea_:

• d1dpea_ first appeared (with stable ids) in SCOP 1.55, called d1dpe__
  
• d1dpea_ appears in SCOP 1.73
  
• d1dpea_ appears in SCOPe 2.01
  
• d1dpea_ appears in the current release, SCOPe 2.08