![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
![]() | Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) ![]() |
![]() | Family d.14.1.2: RNase P protein [54220] (2 proteins) automatically mapped to Pfam PF00825 |
![]() | Protein automated matches [357987] (2 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:1280] [357988] (2 PDB entries) |
![]() | Domain d6d1ra_: 6d1r A: [357989] automated match to d1d6ta_ |
PDB Entry: 6d1r (more details), 2 Å
SCOPe Domain Sequences for d6d1ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6d1ra_ d.14.1.2 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]} kayrikknadfqriykkghsvanrqfvvytcnnkeidhfrlgisvskklgnavlrnkikr airenfkvhkshilakdiiviarqpakdmttlqiqnslehvlkiakvfn
Timeline for d6d1ra_: