SCOPe 2.08: Domain d6dg2d1: 6dg2 D:2-108

Lineage for d6dg2d1 (6dg2 D:2-108)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d6dg2d1: 6dg2 D:2-108 [357983]
   Other proteins in same PDB: d6dg2a2, d6dg2b2, d6dg2c2, d6dg2d2
   automated match to d1n0xl1

Details for d6dg2d1

PDB Entry: 6dg2, 1.96 Å

PDB Description: antigen binding fragment of the pan-ebolavirus monoclonal antibody 6d6

PDB Compounds: (D:) 6D6 Fab light chain

SCOPe Domain Sequences for d6dg2d1:

Sequence; same for both SEQRES and ATOM records:

>d6dg2d1 b.1.1.0 (D:2-108) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ivvtqshkfmstsvgdrvsitckasqdvsvavawyqqktgqspklliysasyritgvpdr
ftgsgsgtdftftissvqaedmavyycqqhystppwtfgggtkleik

Timeline for d6dg2d1:

• d6dg2d1 first appeared in SCOPe 2.07