Lineage for d6djlh_ (6djl H:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. Protein automated matches [190123] (156 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [186862] (206 PDB entries)
  8. Domain d6djlh_: 6djl H: [357982]
    automated match to d2bcgy_

Details for d6djlh_

PDB Entry: 6djl (more details), 3.1 Å

PDB Description: crystal structure of the rab11 gef sh3bp5 bound to nucleotide free rab11a
PDB Compounds: (H:) Ras-related protein Rab-11A

SCOPe Domain Sequences for d6djlh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6djlh_ c.37.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
deydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiw
dtagleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnk
sdlrhlravptdearafaeknglsfietsaldstnveaafqtilteiyrivsqkqms

SCOPe Domain Coordinates for d6djlh_ are not available.

Timeline for d6djlh_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6djla_, d6djlf_, d6djlg_