Lineage for d6cfna_ (6cfn A:)

  1. Root: SCOPe 2.08
  2. Class g: Small proteins [56992] (100 folds)
  3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. Family g.39.1.2: Nuclear receptor [57721] (13 proteins)
    duplication: two zinc-binding motifs
  6. Protein Glucocorticoid receptor DNA-binding domain [57730] (2 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [419793] (1 PDB entry)
  8. Domain d6cfna_: 6cfn A: [357981]
    automated match to d1kb2b_
    complexed with zn

Details for d6cfna_

PDB Entry: 6cfn (more details), 2.5 Å

PDB Description: crystal structure of the dna-free glucocorticoid receptor dna binding domain
PDB Compounds: (A:) Glucocorticoid receptor

SCOPe Domain Sequences for d6cfna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cfna_ g.39.1.2 (A:) Glucocorticoid receptor DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
klclvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncpacry
rkclqagmnlearktkkkik

SCOPe Domain Coordinates for d6cfna_ are not available.

Timeline for d6cfna_:

Domains from other chains:
(mouse over for more information)
d6cfnb_, d6cfnc_, d6cfnd_, d6cfne_, d6cfnf_, d6cfng_, d6cfnh_