Lineage for d6cfnh_ (6cfn H:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035586Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 3035587Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 3035613Family g.39.1.2: Nuclear receptor [57721] (13 proteins)
    duplication: two zinc-binding motifs
  6. 3035629Protein Glucocorticoid receptor DNA-binding domain [57730] (2 species)
  7. 3035630Species Human (Homo sapiens) [TaxId:9606] [419793] (1 PDB entry)
  8. 3035638Domain d6cfnh_: 6cfn H: [357968]
    automated match to d1kb2b_
    complexed with zn

Details for d6cfnh_

PDB Entry: 6cfn (more details), 2.5 Å

PDB Description: crystal structure of the dna-free glucocorticoid receptor dna binding domain
PDB Compounds: (H:) Glucocorticoid receptor

SCOPe Domain Sequences for d6cfnh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cfnh_ g.39.1.2 (H:) Glucocorticoid receptor DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
klclvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncpacry
rkclqagmn

SCOPe Domain Coordinates for d6cfnh_:

Click to download the PDB-style file with coordinates for d6cfnh_.
(The format of our PDB-style files is described here.)

Timeline for d6cfnh_: