Lineage for d6b2ha1 (6b2h A:1-147)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)
  6. Protein HIV-1 capsid protein [47945] (1 species)
  7. Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (70 PDB entries)
  8. Domain d6b2ha1: 6b2h A:1-147 [357956]
    Other proteins in same PDB: d6b2ha2
    automated match to d4xfxa1
    complexed with cl, iod; mutant

Details for d6b2ha1

PDB Entry: 6b2h (more details), 2.6 Å

PDB Description: p38a/t216i mutant of the hiv-1 capsid protein
PDB Compounds: (A:) hiv-1 capsid protein

SCOPe Domain Sequences for d6b2ha1:

Sequence, based on SEQRES records: (download)

>d6b2ha1 a.73.1.1 (A:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlnawvkvveekafspeviamfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmysp

Sequence, based on observed residues (ATOM records): (download)

>d6b2ha1 a.73.1.1 (A:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqqgqmvhqaisprtlnawvkvveekafspeviamfsalsegatpqdlntmlntvggh
qaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmthnp
pipvgeiykrwiilglnkivrmysp

SCOPe Domain Coordinates for d6b2ha1 are not available.

Timeline for d6b2ha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6b2ha2