SCOP 1.75: Domain d2thib_: 2thi B:

Lineage for d2thib_ (2thi B:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (3 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (40 proteins)

6. Protein Thiaminase I [53865] (1 species)
   contains a few additional helices in the C-terminal extension; homologous to MBP

7. Species Paenibacillus thiaminolyticus [TaxId:49283] [53866] (3 PDB entries)

8. Domain d2thib_: 2thi B: [35795]
   complexed with so4

Details for d2thib_

PDB Entry: 2thi, 2.5 Å

PDB Description: thiaminase i from bacillus thiaminolyticus

PDB Compounds: (B:) thiaminase I

SCOP Domain Sequences for d2thib_:

Sequence; same for both SEQRES and ATOM records:

>d2thib_ c.94.1.1 (B:) Thiaminase I {Paenibacillus thiaminolyticus [TaxId: 49283]}
itlkvaiypyvpdparfqaavldqwqrqepgvkleftdwdsysadppddldvfvldsifl
shfvdagyllpfgsqdidqaedvlpfalqgakrngevyglpqilctnllfyrkgdlkigq
vdniyelykkigtshseqipppqnkgllinmaggttkasmylealidvtgqyteydllpp
ldplndkvirglrllinmagekpsqyvpedgdayvraswfaqgsgrafigysesmmrmgd
yaeqvrfkpisssagqdiplfysdvvsvnsktahpelakklanvmasadtveqalrpqad
gqypqyllparhqvyealmqdypiyselaqivnkpsnrvfrlgpevrtwlkdakqvlpea
lg

Timeline for d2thib_:

• d2thib_ first appeared (with stable ids) in SCOP 1.55
  
• d2thib_ appears in SCOP 1.73
  
• d2thib_ appears in SCOPe 2.01
  
• d2thib_ appears in the current release, SCOPe 2.08