Lineage for d4thia_ (4thi A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 846191Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 846192Superfamily c.94.1: Periplasmic binding protein-like II [53850] (3 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 846193Family c.94.1.1: Phosphate binding protein-like [53851] (40 proteins)
  6. 846778Protein Thiaminase I [53865] (1 species)
    contains a few additional helices in the C-terminal extension; homologous to MBP
  7. 846779Species Paenibacillus thiaminolyticus [TaxId:49283] [53866] (3 PDB entries)
  8. 846781Domain d4thia_: 4thi A: [35793]
    complexed with so4

Details for d4thia_

PDB Entry: 4thi (more details), 2 Å

PDB Description: thiaminase i from bacillus thiaminolyticus with covalently bound 4-amino-2,5-dimethylpyrimidine
PDB Compounds: (A:) protein (thiaminase I)

SCOP Domain Sequences for d4thia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4thia_ c.94.1.1 (A:) Thiaminase I {Paenibacillus thiaminolyticus [TaxId: 49283]}
itlkvaiypyvpdparfqaavldqwqrqepgvkleftdwdsysadppddldvfvldsifl
shfvdagyllpfgsqdidqaedvlpfalqgakrngevyglpqilctnllfyrkgdlkigq
vdniyelykkigtshseqipppqnkgllinmaggttkasmylealidvtgqyteydllpp
ldplndkvirglrllinmagekpsqyvpedgdayvraswfaqgsgrafigysesmmrmgd
yaeqvrfkpisssagqdiplfysdvvsvnsktahpelakklanvmasadtveqalrpqad
gqypqyllparhqvyealmqdypiyselaqivnkpsnrvfrlgpevrtwlkdakqvlpea
lg

SCOP Domain Coordinates for d4thia_:

Click to download the PDB-style file with coordinates for d4thia_.
(The format of our PDB-style files is described here.)

Timeline for d4thia_: