SCOP 1.75: Domain d4thia_: 4thi A:

Lineage for d4thia_ (4thi A:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (3 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (40 proteins)

6. Protein Thiaminase I [53865] (1 species)
   contains a few additional helices in the C-terminal extension; homologous to MBP

7. Species Paenibacillus thiaminolyticus [TaxId:49283] [53866] (3 PDB entries)

8. Domain d4thia_: 4thi A: [35793]
   complexed with so4

Details for d4thia_

PDB Entry: 4thi, 2 Å

PDB Description: thiaminase i from bacillus thiaminolyticus with covalently bound 4-amino-2,5-dimethylpyrimidine

PDB Compounds: (A:) protein (thiaminase I)

SCOP Domain Sequences for d4thia_:

Sequence; same for both SEQRES and ATOM records:

>d4thia_ c.94.1.1 (A:) Thiaminase I {Paenibacillus thiaminolyticus [TaxId: 49283]}
itlkvaiypyvpdparfqaavldqwqrqepgvkleftdwdsysadppddldvfvldsifl
shfvdagyllpfgsqdidqaedvlpfalqgakrngevyglpqilctnllfyrkgdlkigq
vdniyelykkigtshseqipppqnkgllinmaggttkasmylealidvtgqyteydllpp
ldplndkvirglrllinmagekpsqyvpedgdayvraswfaqgsgrafigysesmmrmgd
yaeqvrfkpisssagqdiplfysdvvsvnsktahpelakklanvmasadtveqalrpqad
gqypqyllparhqvyealmqdypiyselaqivnkpsnrvfrlgpevrtwlkdakqvlpea
lg

Timeline for d4thia_:

• d4thia_ first appeared (with stable ids) in SCOP 1.55
  
• d4thia_ appears in SCOP 1.73
  
• d4thia_ appears in SCOPe 2.01
  
• d4thia_ appears in the current release, SCOPe 2.08