Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (3 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (40 proteins) |
Protein Thiaminase I [53865] (1 species) contains a few additional helices in the C-terminal extension; homologous to MBP |
Species Paenibacillus thiaminolyticus [TaxId:49283] [53866] (3 PDB entries) |
Domain d3thia_: 3thi A: [35792] complexed with so4 |
PDB Entry: 3thi (more details), 2 Å
SCOP Domain Sequences for d3thia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3thia_ c.94.1.1 (A:) Thiaminase I {Paenibacillus thiaminolyticus [TaxId: 49283]} itlkvaiypyvpdparfqaavldqwqrqepgvkleftdwdsysadppddldvfvldsifl shfvdagyllpfgsqdidqaedvlpfalqgakrngevyglpqilctnllfyrkgdlkigq vdniyelykkigtshseqipppqnkgllinmaggttkasmylealidvtgqyteydllpp ldplndkvirglrllinmagekpsqyvpedgdayvraswfaqgsgrafigysesmmrmgd yaeqvrfkpisssagqdiplfysdvvsvnsktahpelakklanvmasadtveqalrpqad gqypqyllparhqvyealmqdypiyselaqivnkpsnrvfrlgpevrtwlkdakqvlpea lg
Timeline for d3thia_: