SCOPe 2.08: Domain d5yrti_: 5yrt I:

Lineage for d5yrti_ (5yrt I:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
   core: 3 helices; bundle, open

4. Superfamily a.23.2: Diol dehydratase, gamma subunit [47148] (1 family)
   contains irregular N-terminal subdomain
   automatically mapped to Pfam PF02287

5. Family a.23.2.1: Diol dehydratase, gamma subunit [47149] (2 proteins)

6. Protein automated matches [357833] (1 species)
   not a true protein

7. Species Klebsiella oxytoca [TaxId:571] [357834] (3 PDB entries)

8. Domain d5yrti_: 5yrt I: [357917]
   Other proteins in same PDB: d5yrta_, d5yrtb1, d5yrtb2, d5yrtd_, d5yrte_, d5yrtg_, d5yrth_, d5yrtj_, d5yrtk1, d5yrtk2
   automated match to d3aujg_
   complexed with 5ad, b12, ca, cl, k

Details for d5yrti_

PDB Entry: 5yrt, 1.7 Å

PDB Description: diol dehydratase, adocbl/substrate-free, anaerobically-prepared crystal

PDB Compounds: (I:) diol dehydrase gamma subunit

SCOPe Domain Sequences for d5yrti_:

Sequence; same for both SEQRES and ATOM records:

>d5yrti_ a.23.2.1 (I:) automated matches {Klebsiella oxytoca [TaxId: 571]}
arvsdyplankhpewvktatnktlddftlenvlsnkvtaqdmritpetlrlqasiakdag
rdrlamnferaaeltavpddrileiynalrpyrstkeellaiaddlesryqakicaafvr
eaatlyverkklkgdd

Timeline for d5yrti_:

• d5yrti_ first appeared in SCOPe 2.07