SCOPe 2.08: Domain d1elja_: 1elj A:

Lineage for d1elja_ (1elj A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein D-maltodextrin-binding protein, MBP [53862] (5 species)
   contains a few additional helices in the C-terminal extension; homologous to thiaminase I

7. Species Pyrococcus furiosus [TaxId:2261] [53864] (1 PDB entry)

8. Domain d1elja_: 1elj A: [35791]
   complexed with so4
   has additional insertions and/or extensions that are not grouped together

Details for d1elja_

PDB Entry: 1elj, 1.85 Å

PDB Description: the crystal structure of liganded maltodextrin-binding protein from pyrococcus furiosus

PDB Compounds: (A:) maltodextrin-binding protein

SCOPe Domain Sequences for d1elja_:

Sequence; same for both SEQRES and ATOM records:

>d1elja_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Pyrococcus furiosus [TaxId: 2261]}
mkieegkvviwhamqpnelevfqslaeeymalcpeveivfeqkpnledalkaaiptgqgp
dlfiwahdwigkfaeagllepideyvtedllnefapmaqdamqykghyyalpfaaetvai
iynkemvseppktfdemkaimekyydpanekygiawpinayfisaiaqafggyyfddkte
qpgldkpetiegfkfffteiwpymaptgdyntqqsiflegrapmmvngpwsindvkkagi
nfgvvplppiikdgkeywprpyggvkliyfaagiknkdaawkfakwlttseesiktlale
lgyipvltkvlddpeikndpviygfgqavqhaylmpkspkmsavwggvdgaineilqdpq
nadiegilkkyqqeilnnmq

Timeline for d1elja_:

• d1elja_ first appeared (with stable ids) in SCOP 1.55
  
• d1elja_ appears in SCOPe 2.07