SCOP 1.57: Domain d1a7lb_: 1a7l B:

Lineage for d1a7lb_ (1a7l B:)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families)

5. Family c.94.1.1: Phosphate binding protein-like [53851] (17 proteins)

6. Protein D-maltodextrin-binding protein, MBP [53862] (3 species)

7. Species Escherichia coli [TaxId:562] [53863] (22 PDB entries)

8. Domain d1a7lb_: 1a7l B: [35788]

Details for d1a7lb_

PDB Entry: 1a7l, 2.9 Å

PDB Description: dominant b-cell epitope from the pres2 region of hepatitis b virus in the form of an inserted peptide segment in maltodextrin-binding protein

SCOP Domain Sequences for d1a7lb_:

Sequence; same for both SEQRES and ATOM records:

>d1a7lb_ c.94.1.1 (B:) D-maltodextrin-binding protein, MBP {Escherichia coli}
egklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdiifwa
hdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkdllp
nppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikdvgv
dnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskvnyg
vtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplgava
lksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdealkd
gsqdprvrglyf

Timeline for d1a7lb_:

• d1a7lb_ first appeared (with stable ids) in SCOP 1.55
  
• d1a7lb_ appears in SCOP 1.59
  
• d1a7lb_ appears in the current release, SCOPe 2.08