Lineage for d5zjnb_ (5zjn B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. Family c.1.2.5: NanE-like [117362] (1 protein)
    Pfam PF04131
  6. Protein Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE [117363] (3 species)
  7. Species Vibrio cholerae [TaxId:666] [357870] (2 PDB entries)
  8. Domain d5zjnb_: 5zjn B: [357871]
    automated match to d1yxya1
    complexed with edo, lry, peg, pge

Details for d5zjnb_

PDB Entry: 5zjn (more details), 2.66 Å

PDB Description: structure of n-acetylmannosamine-6-phosphate-2-epimerase from vibrio cholerae with n-acetylmannosamine-6-phosphate
PDB Compounds: (B:) Putative N-acetylmannosamine-6-phosphate 2-epimerase

SCOPe Domain Sequences for d5zjnb_:

Sequence, based on SEQRES records: (download)

>d5zjnb_ c.1.2.5 (B:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Vibrio cholerae [TaxId: 666]}
lnieelkrflngqtvvsiqpvtgspldktdfivamaiaveqagakalriegvsnvaavsa
avtipiigivkrdlpdspvritpfvsdvdglanagatviafdatnrtrpesreriaqaik
ntgcfamadcstfedglwansqgveivgstlsgyvgdieptvpdfqlvkafseagfftma
egryntpelaakaiesgavavtvgsaltrlevvtqwfnnatqaager

Sequence, based on observed residues (ATOM records): (download)

>d5zjnb_ c.1.2.5 (B:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Vibrio cholerae [TaxId: 666]}
lnieelkrflngqtvvsiqpvtgspldktdfivamaiaveqagakalriegvsnvaavsa
avtipiigivkrdlpdspvritpfvsdvdglanagatviafdatnrtrpesreriaqaik
ntgcfamadcstfedglwansqgveivgstlsgyvptvpdfqlvkafseagfftmaegry
ntpelaakaiesgavavtvgsaltrlevvtqwfnnatqaager

SCOPe Domain Coordinates for d5zjnb_ are not available.

Timeline for d5zjnb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5zjna_