SCOPe 2.07: Domain d6cw2b2: 6cw2 B:109-215

Lineage for d6cw2b2 (6cw2 B:109-215)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d6cw2b2: 6cw2 B:109-215 [357863]
   Other proteins in same PDB: d6cw2b1
   automated match to d4jg1l2
   complexed with zn

Details for d6cw2b2

PDB Entry: 6cw2, 2.67 Å

PDB Description: crystal structure of a yeast saga transcriptional coactivator ada2/gcn5 hat subcomplex, crystal form 1

PDB Compounds: (B:) Antibody Light Chain

SCOPe Domain Sequences for d6cw2b2:

Sequence, based on SEQRES records:

>d6cw2b2 b.1.1.2 (B:109-215) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdsqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

Sequence, based on observed residues (ATOM records):

>d6cw2b2 b.1.1.2 (B:109-215) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdsqlksgtasvvcllnnfypreakvqwkvnsqesvteqdskdstys
lsstltlsyacevthqglsspvtksfnrgec

Timeline for d6cw2b2:

• d6cw2b2 is new in SCOPe 2.07-stable
  
• d6cw2b2 appears in the current release, SCOPe 2.08