Lineage for d5yrvi_ (5yrv I:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699273Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
    core: 3 helices; bundle, open
  4. 2699281Superfamily a.23.2: Diol dehydratase, gamma subunit [47148] (1 family) (S)
    contains irregular N-terminal subdomain
    automatically mapped to Pfam PF02287
  5. 2699282Family a.23.2.1: Diol dehydratase, gamma subunit [47149] (2 proteins)
  6. 2699306Protein automated matches [357833] (1 species)
    not a true protein
  7. 2699307Species Klebsiella oxytoca [TaxId:571] [357834] (3 PDB entries)
  8. 2699310Domain d5yrvi_: 5yrv I: [357835]
    Other proteins in same PDB: d5yrva_, d5yrvb1, d5yrvb2, d5yrvd_, d5yrve_, d5yrvg_, d5yrvh_, d5yrvj_, d5yrvk1, d5yrvk2
    automated match to d3aujg_
    complexed with 5ad, b12, ca, cl, k, pgo

Details for d5yrvi_

PDB Entry: 5yrv (more details), 1.55 Å

PDB Description: diol dehydratase, adocbl/1,2-propanediol, anaerobically-prepared crystal
PDB Compounds: (I:) diol dehydrase gamma subunit

SCOPe Domain Sequences for d5yrvi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yrvi_ a.23.2.1 (I:) automated matches {Klebsiella oxytoca [TaxId: 571]}
arvsdyplankhpewvktatnktlddftlenvlsnkvtaqdmritpetlrlqasiakdag
rdrlamnferaaeltavpddrileiynalrpyrstkeellaiaddlesryqakicaafvr
eaatlyverkklkgdd

SCOPe Domain Coordinates for d5yrvi_:

Click to download the PDB-style file with coordinates for d5yrvi_.
(The format of our PDB-style files is described here.)

Timeline for d5yrvi_: