Class a: All alpha proteins [46456] (290 folds) |
Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies) core: 3 helices; bundle, open |
Superfamily a.23.2: Diol dehydratase, gamma subunit [47148] (1 family) contains irregular N-terminal subdomain automatically mapped to Pfam PF02287 |
Family a.23.2.1: Diol dehydratase, gamma subunit [47149] (2 proteins) |
Protein automated matches [357833] (1 species) not a true protein |
Species Klebsiella oxytoca [TaxId:571] [357834] (3 PDB entries) |
Domain d5yrvi_: 5yrv I: [357835] Other proteins in same PDB: d5yrva_, d5yrvb1, d5yrvb2, d5yrvd_, d5yrve_, d5yrvg_, d5yrvh_, d5yrvj_, d5yrvk1, d5yrvk2 automated match to d3aujg_ complexed with 5ad, b12, ca, cl, k, pgo |
PDB Entry: 5yrv (more details), 1.55 Å
SCOPe Domain Sequences for d5yrvi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5yrvi_ a.23.2.1 (I:) automated matches {Klebsiella oxytoca [TaxId: 571]} arvsdyplankhpewvktatnktlddftlenvlsnkvtaqdmritpetlrlqasiakdag rdrlamnferaaeltavpddrileiynalrpyrstkeellaiaddlesryqakicaafvr eaatlyverkklkgdd
Timeline for d5yrvi_: