SCOPe 2.08: Domain d1mdqa_: 1mdq A:

Lineage for d1mdqa_ (1mdq A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein D-maltodextrin-binding protein, MBP [53862] (5 species)
   contains a few additional helices in the C-terminal extension; homologous to thiaminase I

7. Species Escherichia coli [TaxId:562] [53863] (69 PDB entries)
   Uniprot P02928

8. Domain d1mdqa_: 1mdq A: [35783]
   mutant
   has additional insertions and/or extensions that are not grouped together

Details for d1mdqa_

PDB Entry: 1mdq, 1.9 Å

PDB Description: refined structures of two insertion(slash)deletion mutants probe function of the maltodextrin binding protein

PDB Compounds: (A:) maltodextrin binding protein

SCOPe Domain Sequences for d1mdqa_:

Sequence; same for both SEQRES and ATOM records:

>d1mdqa_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Escherichia coli [TaxId: 562]}
kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
gsvalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvde
alkdaqtritk

Timeline for d1mdqa_:

• d1mdqa_ first appeared (with stable ids) in SCOP 1.55, called d1mdq__
  
• d1mdqa_ appears in SCOPe 2.07