Lineage for d6d5ja_ (6d5j A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2474875Family c.37.1.8: G proteins [52592] (80 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2475032Protein cH-p21 Ras protein [52593] (1 species)
  7. 2475033Species Human (Homo sapiens) [TaxId:9606] [52594] (155 PDB entries)
    Uniprot Q6P716
  8. 2475153Domain d6d5ja_: 6d5j A: [357828]
    Other proteins in same PDB: d6d5jb1, d6d5jb2, d6d5jc2
    automated match to d1nvvq_
    complexed with fmt, fv4, gnp, gol, mg, na

Details for d6d5ja_

PDB Entry: 6d5j (more details), 1.75 Å

PDB Description: ras:sos:ras in complex with a small molecule activator
PDB Compounds: (A:) gtpase hras

SCOPe Domain Sequences for d6d5ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d5ja_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeasamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh

SCOPe Domain Coordinates for d6d5ja_:

Click to download the PDB-style file with coordinates for d6d5ja_.
(The format of our PDB-style files is described here.)

Timeline for d6d5ja_: