SCOPe 2.08: Domain d5os9b_: 5os9 B:

Lineage for d5os9b_ (5os9 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.142: DNA-binding pseudobarrel domain [101935] (1 superfamily)
   core: barrel, open; n=7, S*=10; capped with helices at both ends; partial similarity to the AbrB/MazE/MraZ-like fold (89446)

4. Superfamily b.142.1: DNA-binding pseudobarrel domain [101936] (2 families)

5. Family b.142.1.2: B3 DNA binding domain [117343] (3 proteins)
   Pfam PF02362

6. Protein automated matches [357795] (1 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [357796] (1 PDB entry)

8. Domain d5os9b_: 5os9 B: [357810]
   automated match to d1wida_

Details for d5os9b_

PDB Entry: 5os9, 1.8 Å

PDB Description: structure of the b3 dna-binding domain of nga1

PDB Compounds: (B:) B3 domain-containing transcription factor NGA1

SCOPe Domain Sequences for d5os9b_:

Sequence; same for both SEQRES and ATOM records:

>d5os9b_ b.142.1.2 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
adrehmfdkvvtpsdvgklnrlvipkqhaerffpldsssnekglllnfedltgkswrfry
sywnssqsyvmtkgwsrfvkdkkldagdivsfqrcvgdsgrdsrlfidwrrrp

Timeline for d5os9b_:

• d5os9b_ first appeared in SCOPe 2.07