SCOPe 2.08: Domain d5xgka1: 5xgk A:29-232

Lineage for d5xgka1 (5xgk A:29-232)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins)
   duplication: consists of 2 similar domains with 2 repeats in each
   Similar to the Methylmalonyl-CoA epimerase dimer

6. Protein 4-hydroxyphenylpyruvate dioxygenase, HppD [54608] (6 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [110877] (16 PDB entries)
   Uniprot P93836 33-428 ! Uniprot P93836 63-459

8. Domain d5xgka1: 5xgk A:29-232 [357805]
   automated match to d1sp9a1
   complexed with act, fe, tyf

Details for d5xgka1

PDB Entry: 5xgk, 2.8 Å

PDB Description: crystal structure of arabidopsis thaliana 4-hydroxyphenylpyruvate dioxygenase (athppd) complexed with its substrate 4- hydroxyphenylpyruvate acid (hppa)

PDB Compounds: (A:) 4-hydroxyphenylpyruvate dioxygenase

SCOPe Domain Sequences for d5xgka1:

Sequence, based on SEQRES records:

>d5xgka1 d.32.1.3 (A:29-232) 4-hydroxyphenylpyruvate dioxygenase, HppD {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
fskfvrknpksdkfkvkrfhhiefwcgdatnvarrfswglgmrfsaksdlstgnmvhasy
lltsgdlrflftapyspslsageikptttasipsfdhgscrsffsshglgvravaieved
aesafsisvangaipssppivlneavtiaevklygdvvlryvsykaedtekseflpgfer
vedassfpldygirrldhavgnvp

Sequence, based on observed residues (ATOM records):

>d5xgka1 d.32.1.3 (A:29-232) 4-hydroxyphenylpyruvate dioxygenase, HppD {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
fskfvrknpksdkfkvkrfhhiefwcgdatnvarrfswglgmrfsaksdlstgnmvhasy
lltsgdlrflftapyspsptttasipsfdhgscrsffsshglgvravaievedaesafsi
svangaipssppivlneavtiaevklygdvvlryvsflpgfervedpldygirrldhavg
nvp

Timeline for d5xgka1:

• d5xgka1 first appeared in SCOPe 2.07