Lineage for d1ompa_ (1omp A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1008597Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1008598Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1008599Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)
  6. 1008648Protein D-maltodextrin-binding protein, MBP [53862] (5 species)
    contains a few additional helices in the C-terminal extension; homologous to thiaminase I
  7. 1008657Species Escherichia coli [TaxId:562] [53863] (47 PDB entries)
    Uniprot P02928
  8. 1008671Domain d1ompa_: 1omp A: [35778]

Details for d1ompa_

PDB Entry: 1omp (more details), 1.8 Å

PDB Description: crystallographic evidence of a large ligand-induced hinge-twist motion between the two domains of the maltodextrin-binding protein involved in active transport and chemotaxis
PDB Compounds: (A:) d-maltodextrin binding protein

SCOPe Domain Sequences for d1ompa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ompa_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Escherichia coli [TaxId: 562]}
kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea
lkdaqtritk

SCOPe Domain Coordinates for d1ompa_:

Click to download the PDB-style file with coordinates for d1ompa_.
(The format of our PDB-style files is described here.)

Timeline for d1ompa_: