SCOPe 2.08: Domain d6melb1: 6mel B:1-238

Lineage for d6melb1 (6mel B:1-238)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families)

5. Family d.142.1.0: automated matches [227184] (1 protein)
   not a true family

6. Protein automated matches [226904] (39 species)
   not a true protein

7. Species Campylobacter jejuni [TaxId:195099] [357772] (1 PDB entry)

8. Domain d6melb1: 6mel B:1-238 [357773]
   Other proteins in same PDB: d6mela1, d6mela2, d6mela3, d6melb2
   automated match to d2nu8b2
   complexed with cit, cl

Details for d6melb1

PDB Entry: 6mel, 2.06 Å

PDB Description: succinyl-coa synthase from campylobacter jejuni

PDB Compounds: (B:) Succinate--CoA ligase [ADP-forming] subunit beta

SCOPe Domain Sequences for d6melb1:

Sequence; same for both SEQRES and ATOM records:

>d6melb1 d.142.1.0 (B:1-238) automated matches {Campylobacter jejuni [TaxId: 195099]}
mniheyqakaifvdngiptlkgkvafsvdeavanakelggsvwavkaqihaggrglgggv
kiaknldevkdyaskilgmnlvthqtgpegklvqklyiesganivkeyylailfnrmaeq
itiiasseggmdiekvakespekiakvgidpqigfkmfhglevarvlgldkdegkklism
iaklyklymdkdmnmleinpliktaegdfyaldakcsfddsalyrhpeiaelrdttee

Timeline for d6melb1:

• d6melb1 first appeared in SCOPe 2.07