Lineage for d6mdyc1 (6mdy C:1-274)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2443024Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2444581Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2444582Protein automated matches [190115] (91 species)
    not a true protein
  7. 2445019Species Legionella pneumophila [TaxId:272624] [357767] (1 PDB entry)
  8. 2445022Domain d6mdyc1: 6mdy C:1-274 [357768]
    Other proteins in same PDB: d6mdya2, d6mdyb2, d6mdyc2, d6mdyd2
    automated match to d4lu0d_

Details for d6mdyc1

PDB Entry: 6mdy (more details), 2.55 Å

PDB Description: crystal structure of a 2-dehydro-3-deoxyphosphooctonate aldolase from legionella pneumophila philadelphia 1
PDB Compounds: (C:) 2-dehydro-3-deoxyphosphooctonate aldolase

SCOPe Domain Sequences for d6mdyc1:

Sequence, based on SEQRES records: (download)

>d6mdyc1 c.1.10.0 (C:1-274) automated matches {Legionella pneumophila [TaxId: 272624]}
mrlcgfeagldkplfliagpcvieseelaletagylkemcsqlnipfiykssfdkanrss
issyrgpgfekglsilekvksqigvpvltdvhedtplfevssvvdvlqtpaflcrqtnfi
qkvaamnkpvnikkgqflapwemkhviakakaqgneqimacergvsfgynnlvsdmrslv
imretgcpvvydathsvqlpggnngvsggqrefipalaraavavgisglfmethpdpdka
lsdgpnswpldkmkqlleslkaadevykkystdf

Sequence, based on observed residues (ATOM records): (download)

>d6mdyc1 c.1.10.0 (C:1-274) automated matches {Legionella pneumophila [TaxId: 272624]}
mrlcgfeagldkplfliagpcvieseelaletagylkemcsqlnipfiykssffekglsi
lekvksqigvpvltdvhedtplfevssvvdvlqtpaflcrqtnfiqkvaamnkpvnikkg
qflapwemkhviakakaqgneqimacergvsfgynnlvsdmrslvimretgcpvvydath
svqqrefipalaraavavgisglfmethpnswpldkmkqlleslkaadevykkystdf

SCOPe Domain Coordinates for d6mdyc1:

Click to download the PDB-style file with coordinates for d6mdyc1.
(The format of our PDB-style files is described here.)

Timeline for d6mdyc1: