Lineage for d1anf__ (1anf -)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 494730Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 494731Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 494732Family c.94.1.1: Phosphate binding protein-like [53851] (28 proteins)
  6. 494753Protein D-maltodextrin-binding protein, MBP [53862] (4 species)
    contains a few additional helices in the C-terminal extension; homologous to thiaminase I
  7. 494764Species Escherichia coli [TaxId:562] [53863] (37 PDB entries)
  8. 494766Domain d1anf__: 1anf - [35776]

Details for d1anf__

PDB Entry: 1anf (more details), 1.67 Å

PDB Description: maltodextrin binding protein with bound maltose

SCOP Domain Sequences for d1anf__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1anf__ c.94.1.1 (-) D-maltodextrin-binding protein, MBP {Escherichia coli}
kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea
lkdaqtritk

SCOP Domain Coordinates for d1anf__:

Click to download the PDB-style file with coordinates for d1anf__.
(The format of our PDB-style files is described here.)

Timeline for d1anf__: