Lineage for d1anf__ (1anf -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) 
Family c.94.1.1: Phosphate binding protein-like [53851] (16 proteins) 
Protein D-maltodextrin-binding protein, MBP [53862] (2 species) Species Escherichia coli [TaxId:562] [53863] (13 PDB entries) 
Domain d1anf__: 1anf - [35776]
Details for d1anf__
PDB Entry: 1anf (more details), 1.67 Å
PDB Description: maltodextrin binding protein with bound maltose
SCOP Domain Sequences for d1anf__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1anf__ c.94.1.1 (-) D-maltodextrin-binding protein, MBP {Escherichia coli}
kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea
lkdaqtritk
SCOP Domain Coordinates for d1anf__:
Click to download the PDB-style file with coordinates for d1anf__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1anf__:
- d1anf__ appears in SCOP 1.57
- d1anf__ appears in the current release, SCOPe 2.08, called d1anfa_
View in 3D