Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest |
Family c.56.5.8: Glutaminyl-peptide cyclotransferase-like [142532] (1 protein) part of Pfam PF04389 |
Protein Glutaminyl-peptide cyclotransferase, QPCT [142533] (2 species) Glutaminyl cyclase |
Species Human (Homo sapiens) [TaxId:9606] [142534] (29 PDB entries) Uniprot Q16769 33-361 |
Domain d6gbxb_: 6gbx B: [357742] automated match to d3pbea_ complexed with edo, s77, so4, zn |
PDB Entry: 6gbx (more details), 1.72 Å
SCOPe Domain Sequences for d6gbxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6gbxb_ c.56.5.8 (B:) Glutaminyl-peptide cyclotransferase, QPCT {Human (Homo sapiens) [TaxId: 9606]} sawpeeknyhqpailnssalrqiaegtsisemwqndlqpllierypgspgsyaarqhimq riqrlqadwvleidtflsqtpegersfsniistlnptakrhlvlachydskyfshwnnrv fvgatdsavpcammlelaraldkkllslktvsdskpdlslqliffdgeeaflhwspqdsl ygsrhlaakmastphppgargtsqlhgmdllvlldligapnptfpnffpnsarwferlqa iehelhelgllkdhslegryfqnysyggviqddhipflrrgvpvlhlipspfpevwhtmd dneenldestidnlnkilqvfvleylhl
Timeline for d6gbxb_: