Lineage for d1a55a_ (1a55 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2144293Family c.94.1.1: Phosphate binding protein-like [53851] (45 protein domains)
  6. 2145089Protein Phosphate-binding protein [53860] (4 species)
  7. 2145090Species Escherichia coli [TaxId:562] [53861] (13 PDB entries)
  8. 2145102Domain d1a55a_: 1a55 A: [35772]
    complexed with 2hp; mutant

Details for d1a55a_

PDB Entry: 1a55 (more details), 2.4 Å

PDB Description: phosphate-binding protein mutant a197c
PDB Compounds: (A:) phosphate-binding protein

SCOPe Domain Sequences for d1a55a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a55a_ c.94.1.1 (A:) Phosphate-binding protein {Escherichia coli [TaxId: 562]}
easltgagatfpapvyakwadtyqketgnkvnyqgigssggvkqiiantvdfgasdapls
deklaqeglfqfptviggvvlavnipglksgelvldgktlgdiylgkikkwddeaiakln
pglklpsqniavvrradgsgtsfvftsylakvneewknnvgtgstvkwpiglggkgndgi
aafvqrlpgaigyveycyakqnnlaytklisadgkpvspteenfanaakgadwsktfaqd
ltnqkgedawpitsttfilihkdqkkpeqgtevlkffdwayktgakqandldyaslpdsv
veqvraawktnikdssgkply

SCOPe Domain Coordinates for d1a55a_:

Click to download the PDB-style file with coordinates for d1a55a_.
(The format of our PDB-style files is described here.)

Timeline for d1a55a_: