SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1a55a_ (1a55 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2144293Family c.94.1.1: Phosphate binding protein-like [53851] (45 protein domains)
  6. 2145089Protein Phosphate-binding protein [53860] (4 species)
  7. 2145090Species Escherichia coli [TaxId:562] [53861] (13 PDB entries)
  8. 2145102Domain d1a55a_: 1a55 A: [35772]
    complexed with 2hp; mutant

Details for d1a55a_

PDB Entry: 1a55 (more details), 2.4 Å

PDB Description: phosphate-binding protein mutant a197c
PDB Compounds: (A:) phosphate-binding protein

SCOPe Domain Sequences for d1a55a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a55a_ c.94.1.1 (A:) Phosphate-binding protein {Escherichia coli [TaxId: 562]}
easltgagatfpapvyakwadtyqketgnkvnyqgigssggvkqiiantvdfgasdapls
deklaqeglfqfptviggvvlavnipglksgelvldgktlgdiylgkikkwddeaiakln
pglklpsqniavvrradgsgtsfvftsylakvneewknnvgtgstvkwpiglggkgndgi
aafvqrlpgaigyveycyakqnnlaytklisadgkpvspteenfanaakgadwsktfaqd
ltnqkgedawpitsttfilihkdqkkpeqgtevlkffdwayktgakqandldyaslpdsv
veqvraawktnikdssgkply

SCOPe Domain Coordinates for d1a55a_:

Click to download the PDB-style file with coordinates for d1a55a_.
(The format of our PDB-style files is described here.)

Timeline for d1a55a_: