SCOPe 2.08: Domain d6ebpb_: 6ebp B:

Lineage for d6ebpb_ (6ebp B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.0: automated matches [191307] (1 protein)
   not a true family

6. Protein automated matches [190036] (60 species)
   not a true protein

7. Species Aerococcus urinae [TaxId:866775] [357707] (3 PDB entries)

8. Domain d6ebpb_: 6ebp B: [357713]
   automated match to d1oquc_
   complexed with ca, dah, gol

Details for d6ebpb_

PDB Entry: 6ebp, 1.59 Å

PDB Description: crystal structure of the class ie ribonucleotide reductase beta subunit from aerococcus urinae in activated form

PDB Compounds: (B:) Ribonucleoside-diphosphate reductase, beta subunit

SCOPe Domain Sequences for d6ebpb_:

Sequence; same for both SEQRES and ATOM records:

>d6ebpb_ a.25.1.0 (B:) automated matches {Aerococcus urinae [TaxId: 866775]}
nyydrsvspveyayfdqsqnmrainwnkivdekdlevwnrvtqnfwlpenipvsndlpsw
neldddwqqlitrtftgltlldtvqssigdvaqiknslteqeqviyanfafmvgvharsf
gtifstlctseqieeahewvvdnealqarpkalipfytaddplkskiaaalmpgfllygg
fylpfylsargklpntsdiirlilrdkvihnfysgykyqlkvaklspekqaemkqfvfdl
ldkmiglektylhqlydgfgladeairfslynagkflqnlgyespftkeetriapevfaq
lsaradenhdf

Timeline for d6ebpb_:

• d6ebpb_ first appeared in SCOPe 2.07