Lineage for d6dmxd_ (6dmx D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697639Fold a.12: Kix domain of CBP (creb binding protein) [47039] (1 superfamily)
    3 helices; bundle, partly opened
  4. 2697640Superfamily a.12.1: Kix domain of CBP (creb binding protein) [47040] (1 family) (S)
    automatically mapped to Pfam PF02172
  5. 2697641Family a.12.1.1: Kix domain of CBP (creb binding protein) [47041] (1 protein)
  6. 2697642Protein Kix domain of CBP (creb binding protein) [47042] (1 species)
  7. 2697643Species Mouse (Mus musculus) [TaxId:10090] [47043] (13 PDB entries)
  8. 2697649Domain d6dmxd_: 6dmx D: [357704]
    automated match to d5u4ka_

Details for d6dmxd_

PDB Entry: 6dmx (more details), 2.8 Å

PDB Description: hbz56 in complex with kix and c-myb
PDB Compounds: (D:) creb-binding protein

SCOPe Domain Sequences for d6dmxd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dmxd_ a.12.1.1 (D:) Kix domain of CBP (creb binding protein) {Mouse (Mus musculus) [TaxId: 10090]}
whehvtqdlrshlvhklvqaifptpdpaalkdrrmenlvayakkvegdmyesansrdeyy
hllaekiykiqkeleekrrsr

SCOPe Domain Coordinates for d6dmxd_:

Click to download the PDB-style file with coordinates for d6dmxd_.
(The format of our PDB-style files is described here.)

Timeline for d6dmxd_: