SCOPe 2.08: Domain d6dznl2: 6dzn L:108-214

Lineage for d6dznl2 (6dzn L:108-214)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d6dznl2: 6dzn L:108-214 [357694]
   Other proteins in same PDB: d6dznh_, d6dznl1
   automated match to d1n0xl2
   complexed with ae3, cl, pg4

Details for d6dznl2

PDB Entry: 6dzn, 2.1 Å

PDB Description: pan-ebolavirus human antibody adi-15878 fab

PDB Compounds: (L:) Antibody ADI-15878, light chain

SCOPe Domain Sequences for d6dznl2:

Sequence; same for both SEQRES and ATOM records:

>d6dznl2 b.1.1.2 (L:108-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglrspvtksfnrgec

Timeline for d6dznl2:

• d6dznl2 first appeared in SCOPe 2.07