SCOP 1.57: Domain d1a40__: 1a40 -

Lineage for d1a40__ (1a40 -)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families)

5. Family c.94.1.1: Phosphate binding protein-like [53851] (17 proteins)

6. Protein Phosphate-binding protein [53860] (1 species)

7. Species Escherichia coli [TaxId:562] [53861] (13 PDB entries)

8. Domain d1a40__: 1a40 - [35767]

Details for d1a40__

PDB Entry: 1a40, 1.7 Å

PDB Description: phosphate-binding protein with ala 197 replaced with trp

SCOP Domain Sequences for d1a40__:

Sequence; same for both SEQRES and ATOM records:

>d1a40__ c.94.1.1 (-) Phosphate-binding protein {Escherichia coli}
easltgagatfpapvyakwadtyqketgnkvnyqgigssggvkqiiantvdfgasdapls
deklaqeglfqfptviggvvlavnipglksgelvldgktlgdiylgkikkwddeaiakln
pglklpsqniavvrradgsgtsfvftsylakvneewknnvgtgstvkwpiglggkgndgi
aafvqrlpgaigyveywyakqnnlaytklisadgkpvspteenfanaakgadwsktfaqd
ltnqkgedawpitsttfilihkdqkkpeqgtevlkffdwayktgakqandldyaslpdsv
veqvraawktnikdssgkply

Timeline for d1a40__:

• d1a40__ first appeared (with stable ids) in SCOP 1.55
  
• d1a40__ appears in SCOP 1.59
  
• d1a40__ appears in the current release, SCOPe 2.08, called d1a40a_