Lineage for d6d55b1 (6d55 B:566-1046)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.117: Ras GEF [48365] (1 superfamily)
    multihelical
  4. Superfamily a.117.1: Ras GEF [48366] (1 family) (S)
  5. Family a.117.1.1: Ras GEF [48367] (2 proteins)
  6. Protein Son of sevenless protein homolog 1 (sos-1) [48368] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [48369] (60 PDB entries)
    Uniprot Q07889 189-1046
  8. Domain d6d55b1: 6d55 B:566-1046 [357667]
    Other proteins in same PDB: d6d55a_, d6d55b2, d6d55c1, d6d55c2
    automated match to d1nvus_
    complexed with fmt, fwa, gnp, gol, mg, na

Details for d6d55b1

PDB Entry: 6d55 (more details), 1.6800000000000002 Å

PDB Description: ras:sos:ras in complex with a small molecule activator
PDB Compounds: (B:) Son of sevenless homolog 1

SCOPe Domain Sequences for d6d55b1:

Sequence, based on SEQRES records: (download)

>d6d55b1 a.117.1.1 (B:566-1046) Son of sevenless protein homolog 1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]}
qmrlpsadvyrfaepdseeniifeenmqpkagipiikagtviklierltyhmyadpnfvr
tflttyrsfckpqellsliierfeipepepteadriaiengdqplsaelkrfrkeyiqpv
qlrvlnvcrhwvehhfydferdayllqrmeefigtvrgkamkkwvesitkiiqrkkiard
ngpghnitfqsspptvewhisrpghietfdlltlhpieiarqltllesdlyravqpselv
gsvwtkedkeinspnllkmirhttnltlwfekcivetenleervavvsriieilqvfqel
nnfngvlevvsamnsspvyrldhtfeqipsrqkkileeahelsedhykkylaklrsinpp
cvpffgiyltnilkteegnpevlkrhgkelinfskrrkvaeitgeiqqyqnqpyclrves
dikrffenlnpmgnsmekeftdylfnksleieprnpkplprfpkkysyplkspgvrpsnp
r

Sequence, based on observed residues (ATOM records): (download)

>d6d55b1 a.117.1.1 (B:566-1046) Son of sevenless protein homolog 1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]}
qmrlpsadvyrfaepdseeniifeegipiikagtviklierltyhmyadpnfvrtfltty
rsfckpqellsliierfeipepepteadriaiengdqplsaelkrfrkeyiqpvqlrvln
vcrhwvehhfydferdayllqrmeefigtvrgkamkkwvesitkiiqrkkianitfqssp
ptvewhisrpghietfdlltlhpieiarqltllesdlyravqpselvgsvwtkedkeins
pnllkmirhttnltlwfekcivetenleervavvsriieilqvfqelnnfngvlevvsam
nsspvyrldhtfeqipsrqkkileeahelsedhykkylaklrsinppcvpffgiyltnil
kteegnpevlkrhgkelinfskrrkvaeitgeiqqyqnqpyclrvesdikrffenlnpmg
nsmekeftdylfnksleieprnpkplprfpkkysyplkspgvrpsnpr

SCOPe Domain Coordinates for d6d55b1 are not available.

Timeline for d6d55b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6d55b2
View in 3D
Domains from other chains:
(mouse over for more information)
d6d55a_, d6d55c1, d6d55c2