SCOPe 2.08: Domain d6baka2: 6bak A:131-318

Lineage for d6baka2 (6bak A:131-318)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.2: GAF domain-like [55781] (5 families)
   alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654

5. Family d.110.2.0: automated matches [191507] (1 protein)
   not a true family

6. Protein automated matches [190838] (19 species)
   not a true protein

7. Species Stigmatella aurantiaca [TaxId:378806] [317295] (3 PDB entries)

8. Domain d6baka2: 6bak A:131-318 [357662]
   Other proteins in same PDB: d6baka1
   automated match to d4rpwa2
   complexed with blr; mutant

Details for d6baka2

PDB Entry: 6bak, 1.92 Å

PDB Description: the structure of the stigmatella aurantiaca phytochrome chromophore binding domain t289h mutant

PDB Compounds: (A:) Photoreceptor-histidine kinase BphP

SCOPe Domain Sequences for d6baka2:

Sequence; same for both SEQRES and ATOM records:

>d6baka2 d.110.2.0 (A:131-318) automated matches {Stigmatella aurantiaca [TaxId: 378806]}
avpflsffhavrdglsrlrdardlqelceavvqevrgltgfdraiiyrfdaewngsviae
ardaradpylglhfpasdiprqarelyqlnwlriiptidyqparvralpghgepldlsfs
vlrsvspihleylhnmgvqasmsislmkdgklwglischqvsgtryvpyevrtaceflge
vmssllaa

Timeline for d6baka2:

• d6baka2 first appeared in SCOPe 2.07