SCOPe 2.06: Domain d1quka_: 1quk A:

Lineage for d1quka_ (1quk A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)

6. Protein Phosphate-binding protein [53860] (4 species)

7. Species Escherichia coli [TaxId:562] [53861] (13 PDB entries)

8. Domain d1quka_: 1quk A: [35765]
   complexed with po4; mutant

Details for d1quka_

PDB Entry: 1quk, 1.7 Å

PDB Description: phosphate-binding protein mutant with asp 137 replaced by asn complex with phosphate

PDB Compounds: (A:) phosphate-binding protein

SCOPe Domain Sequences for d1quka_:

Sequence; same for both SEQRES and ATOM records:

>d1quka_ c.94.1.1 (A:) Phosphate-binding protein {Escherichia coli [TaxId: 562]}
easltgagatfpapvyakwadtyqketgnkvnyqgigssggvkqiiantvdfgasdapls
deklaqeglfqfptviggvvlavnipglksgelvldgktlgdiylgkikkwddeaiakln
pglklpsqniavvrrangsgtsfvftsylakvneewknnvgtgstvkwpiglggkgndgi
aafvqrlpgaigyveyayakqnnlaytklisadgkpvspteenfanaakgadwsktfaqd
ltnqkgedawpitsttfilihkdqkkpeqgtevlkffdwayktgakqandldyaslpdsv
veqvraawktnikdssgkply

Timeline for d1quka_:

• d1quka_ first appeared (with stable ids) in SCOP 1.55, called d1quk__
  
• d1quka_ appears in SCOPe 2.05
  
• d1quka_ appears in SCOPe 2.07
  
• d1quka_ appears in the current release, SCOPe 2.08