SCOPe 2.07: Domain d6bfsl2: 6bfs L:108-212

Lineage for d6bfsl2 (6bfs L:108-212)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)

8. Domain d6bfsl2: 6bfs L:108-212 [357634]
   Other proteins in same PDB: d6bfsc1, d6bfsc2, d6bfsl1
   automated match to d1h3pl2

Details for d6bfsl2

PDB Entry: 6bfs, 2 Å

PDB Description: the mechanism of gm-csf inhibition by human gm-csf auto-antibodies

PDB Compounds: (L:) Fab light chain

SCOPe Domain Sequences for d6bfsl2:

Sequence; same for both SEQRES and ATOM records:

>d6bfsl2 b.1.1.2 (L:108-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d6bfsl2:

• d6bfsl2 is new in SCOPe 2.07-stable
  
• d6bfsl2 appears in the current release, SCOPe 2.08