SCOPe 2.07: Domain d6fuzn1: 6fuz N:6-113

Lineage for d6fuzn1 (6fuz N:6-113)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (223 PDB entries)

8. Domain d6fuzn1: 6fuz N:6-113 [357630]
   Other proteins in same PDB: d6fuzn2
   automated match to d5m2jd_
   complexed with gol

Details for d6fuzn1

PDB Entry: 6fuz, 2.7 Å

PDB Description: crystal structure of the tpr domain of klc1 in complex with the c- terminal peptide of jip1

PDB Compounds: (N:) Nanobody

SCOPe Domain Sequences for d6fuzn1:

Sequence; same for both SEQRES and ATOM records:

>d6fuzn1 b.1.1.1 (N:6-113) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqpggslrlscaasgfafssywmywvrqapekglewvstintgggityykdsvk
grftvsrdnakntlylqmnslkpedaaqyycatdmsgtyrgqgtqvtv

Timeline for d6fuzn1:

• d6fuzn1 is new in SCOPe 2.07-stable
  
• d6fuzn1 appears in the current release, SCOPe 2.08